- SPNS1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92440
- HSpin1, LAT, PP2030, SLC62A1, SLC63A1, SPIN1, SPINL, nrs
- Human
- SPNS1
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: MAGSDTAPFL SQADDPDDGP VPGTPGLPGS TGNPKSEEPE VPDQEGLQRI TGLSPGRS
- Unconjugated
- 0.1 ml (also 25ul)
- SPNS lysolipid transporter 1, lysophospholipid
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Autophagy
Sequence
MAGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRITGLSPGRS
Specifications/Features
Available conjugates: Unconjugated